Recombinant Human GRB2 related adaptor protein 2 Protein, His-tagged

Cat.No. : GRAP2-3432H
Product Overview : Recombinant Human GRAP2 protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-330 aa
Description : This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Mass : 39 kDa
AA Sequence : MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTRHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Concentration : 1 mg/mL by BCA
Gene Name GRAP2 GRB2 related adaptor protein 2 [ Homo sapiens (human) ]
Official Symbol GRAP2
Synonyms GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2;
Gene ID 9402
mRNA Refseq NM_004810
Protein Refseq NP_004801
MIM 604518
UniProt ID O75791

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRAP2 Products

Required fields are marked with *

My Review for All GRAP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon