Recombinant Human GRIA1 protein(391-480 aa), C-His-tagged

• Cat.No.: GRIA1-2760H
• Product Overview: Recombinant Human GRIA1 protein(P42261)(391-480 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 391-480 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 12 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE

Gene Information

• Gene Name: GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ]
• Official Symbol: GRIA1
• Synonyms: GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252
• Gene ID: 2890
• mRNA Refseq: NM_000827
• Protein Refseq: NP_000818
• MIM: 138248
• UniProt ID: P42261