Recombinant Human GRIA1 protein(391-480 aa), C-His-tagged
| Cat.No. : | GRIA1-2760H |
| Product Overview : | Recombinant Human GRIA1 protein(P42261)(391-480 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 391-480 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 12 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | AATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE |
| Gene Name | GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ] |
| Official Symbol | GRIA1 |
| Synonyms | GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252; |
| Gene ID | 2890 |
| mRNA Refseq | NM_000827 |
| Protein Refseq | NP_000818 |
| MIM | 138248 |
| UniProt ID | P42261 |
| ◆ Recombinant Proteins | ||
| GRIA1-236HFL | Active Recombinant Full Length Human GRIA1 Protein, C-Flag-tagged | +Inquiry |
| GRIA1-1973R | Recombinant Rhesus monkey GRIA1 Protein, His-tagged | +Inquiry |
| Gria1-1062M | Recombinant Mouse Gria1 Protein, MYC/DDK-tagged | +Inquiry |
| GRIA1-3288H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
| GRIA1-2641H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRIA1-5748HCL | Recombinant Human GRIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA1 Products
Required fields are marked with *
My Review for All GRIA1 Products
Required fields are marked with *
