Recombinant Human GRIA1 protein(391-480 aa), C-His-tagged

Cat.No. : GRIA1-2760H
Product Overview : Recombinant Human GRIA1 protein(P42261)(391-480 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 391-480 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 12 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : AATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
Gene Name GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ]
Official Symbol GRIA1
Synonyms GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252;
Gene ID 2890
mRNA Refseq NM_000827
Protein Refseq NP_000818
MIM 138248
UniProt ID P42261

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIA1 Products

Required fields are marked with *

My Review for All GRIA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon