Recombinant Human GRIA1 Protein, GST-tagged
| Cat.No. : | GRIA1-5330H |
| Product Overview : | Human GRIA1 partial ORF ( NP_000818, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ] |
| Official Symbol | GRIA1 |
| Synonyms | GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252; |
| Gene ID | 2890 |
| mRNA Refseq | NM_000827 |
| Protein Refseq | NP_000818 |
| MIM | 138248 |
| UniProt ID | P42261 |
| ◆ Recombinant Proteins | ||
| Gria1-1587R | Recombinant Rat Gria1 Protein, His&GST-tagged | +Inquiry |
| GRIA1-1165C | Recombinant Chicken GRIA1 | +Inquiry |
| GRIA1-2760H | Recombinant Human GRIA1 protein(391-480 aa), C-His-tagged | +Inquiry |
| GRIA1-2689R | Recombinant Rat GRIA1 Protein | +Inquiry |
| GRIA1-25H | Recombinant Human GRIA1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRIA1-5748HCL | Recombinant Human GRIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA1 Products
Required fields are marked with *
My Review for All GRIA1 Products
Required fields are marked with *
