Recombinant Human GRIA3 Protein, GST-tagged
Cat.No. : | GRIA3-5331H |
Product Overview : | Human GRIA3 full-length ORF ( NP_871623.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing at this locus results in different isoforms, which may vary in their signal transduction properties. [provided by RefSeq |
Molecular Mass : | 42.5 kDa |
AA Sequence : | MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNACPAERDYLPWPGSIRENNWTALPCCKDHGLLHLKCSPGGARQNWAYCIWGVTGEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRIA3 glutamate receptor, ionotropic, AMPA 3 [ Homo sapiens ] |
Official Symbol | GRIA3 |
Synonyms | GRIA3; glutamate receptor, ionotropic, AMPA 3; GLUR3, glutamate receptor, ionotrophic, AMPA 3; glutamate receptor 3; GluA3; GLURC; MRX94; gluR-3; dJ1171F9.1; glutamate receptor C; glutamate receptor subunit 3; AMPA-selective glutamate receptor 3; glutamate receptor, ionotrophic, AMPA 3; GLUR3; GLUR-C; GLUR-K3; |
Gene ID | 2892 |
mRNA Refseq | NM_000828 |
Protein Refseq | NP_000819 |
MIM | 305915 |
UniProt ID | P42263 |
◆ Recombinant Proteins | ||
GRIA3-1405H | Recombinant Human GRIA3 Protein (151-250 aa), His-tagged | +Inquiry |
GRIA3-6768C | Recombinant Chicken GRIA3 | +Inquiry |
GRIA3-27524TH | Recombinant Human GRIA3 | +Inquiry |
GRIA3-2761H | Recombinant Human GRIA3 protein(741-810 aa), C-His-tagged | +Inquiry |
GRIA3-5331H | Recombinant Human GRIA3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIA3-752HCL | Recombinant Human GRIA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA3 Products
Required fields are marked with *
My Review for All GRIA3 Products
Required fields are marked with *
0
Inquiry Basket