Recombinant Human GRIK1
Cat.No. : | GRIK1-28537TH |
Product Overview : | Recombinant fragment of Human GRIK1 amino acids 331-440 with a N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Most abundant in the cerebellum and the suprachiasmatic nuclei (SCN) of the hypothalamus. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWD GLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKH LYKVWKKIGIWNSNSGLNMTDSNKDKSSNI |
Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK1 subfamily. |
Gene Name | GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ] |
Official Symbol | GRIK1 |
Synonyms | GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; |
Gene ID | 2897 |
mRNA Refseq | NM_000830 |
Protein Refseq | NP_000821 |
MIM | 138245 |
Uniprot ID | P39086 |
Chromosome Location | 21q22 |
Pathway | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of Na-permeable Kainate Receptors, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; |
Function | drug binding; extracellular-glutamate-gated ion channel activity; glutamate binding; ion channel activity; kainate selective glutamate receptor activity; |
◆ Recombinant Proteins | ||
GRIK1-2695R | Recombinant Rat GRIK1 Protein | +Inquiry |
GRIK1-28537TH | Recombinant Human GRIK1 | +Inquiry |
GRIK1-566C | Recombinant Cynomolgus GRIK1 Protein, His-tagged | +Inquiry |
GRIK1-312C | Recombinant Cynomolgus Monkey GRIK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIK1-5336H | Recombinant Human GRIK1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRIK1 Products
Required fields are marked with *
My Review for All GRIK1 Products
Required fields are marked with *
0
Inquiry Basket