Recombinant Human GRIK1
| Cat.No. : | GRIK1-28537TH |
| Product Overview : | Recombinant fragment of Human GRIK1 amino acids 331-440 with a N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Most abundant in the cerebellum and the suprachiasmatic nuclei (SCN) of the hypothalamus. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWD GLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKH LYKVWKKIGIWNSNSGLNMTDSNKDKSSNI |
| Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK1 subfamily. |
| Gene Name | GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ] |
| Official Symbol | GRIK1 |
| Synonyms | GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; |
| Gene ID | 2897 |
| mRNA Refseq | NM_000830 |
| Protein Refseq | NP_000821 |
| MIM | 138245 |
| Uniprot ID | P39086 |
| Chromosome Location | 21q22 |
| Pathway | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of Na-permeable Kainate Receptors, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; |
| Function | drug binding; extracellular-glutamate-gated ion channel activity; glutamate binding; ion channel activity; kainate selective glutamate receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIK1 Products
Required fields are marked with *
My Review for All GRIK1 Products
Required fields are marked with *



