Recombinant Human GRIK1

Cat.No. : GRIK1-28537TH
Product Overview : Recombinant fragment of Human GRIK1 amino acids 331-440 with a N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Most abundant in the cerebellum and the suprachiasmatic nuclei (SCN) of the hypothalamus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWD GLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKH LYKVWKKIGIWNSNSGLNMTDSNKDKSSNI
Sequence Similarities : Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK1 subfamily.
Gene Name GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ]
Official Symbol GRIK1
Synonyms GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1;
Gene ID 2897
mRNA Refseq NM_000830
Protein Refseq NP_000821
MIM 138245
Uniprot ID P39086
Chromosome Location 21q22
Pathway Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of Na-permeable Kainate Receptors, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem;
Function drug binding; extracellular-glutamate-gated ion channel activity; glutamate binding; ion channel activity; kainate selective glutamate receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIK1 Products

Required fields are marked with *

My Review for All GRIK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon