Recombinant Human GRIK1 Protein, GST-tagged
| Cat.No. : | GRIK1-5336H |
| Product Overview : | Human GRIK1 partial ORF ( NP_000821, 331 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ] |
| Official Symbol | GRIK1 |
| Synonyms | GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; GluK1; gluR-5; glutamate receptor 5; excitatory amino acid receptor 3; EAA3; EEA3; GLR5; |
| Gene ID | 2897 |
| mRNA Refseq | NM_000830 |
| Protein Refseq | NP_000821 |
| MIM | 138245 |
| UniProt ID | P39086 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIK1 Products
Required fields are marked with *
My Review for All GRIK1 Products
Required fields are marked with *



