Recombinant Human GRIK1 Protein, GST-tagged

Cat.No. : GRIK1-5336H
Product Overview : Human GRIK1 partial ORF ( NP_000821, 331 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ]
Official Symbol GRIK1
Synonyms GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1; GluK1; gluR-5; glutamate receptor 5; excitatory amino acid receptor 3; EAA3; EEA3; GLR5;
Gene ID 2897
mRNA Refseq NM_000830
Protein Refseq NP_000821
MIM 138245
UniProt ID P39086

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRIK1 Products

Required fields are marked with *

My Review for All GRIK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon