Recombinant Human GSDMA Protein, GST-tagged
Cat.No. : | GSDMA-4390H |
Product Overview : | Human GSDMA full-length ORF (BAC04790.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GSDMA (Gasdermin A) is a Protein Coding gene. Diseases associated with GSDMA include Retinitis Pigmentosa 23. An important paralog of this gene is GSDMC. |
Molecular Mass : | 75.8 kDa |
AA Sequence : | MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSHLQQLTKAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSDMA gasdermin A [ Homo sapiens ] |
Official Symbol | GSDMA |
Synonyms | GSDMA; gasdermin A; gasdermin , gasdermin 1 , GSDM, GSDM1; gasdermin-A; FLJ39120; gasdermin 1; gasdermin-1; GSDM; FKSG9; GSDM1; MGC129596; |
Gene ID | 284110 |
mRNA Refseq | NM_178171 |
Protein Refseq | NP_835465 |
MIM | 611218 |
UniProt ID | Q96QA5 |
◆ Recombinant Proteins | ||
GSDMA-7304M | Recombinant Mouse GSDMA Protein | +Inquiry |
GSDMA-1023H | Recombinant Human GSDMA Protein, His (Fc)-Avi-tagged | +Inquiry |
GSDMA-3324HF | Recombinant Full Length Human GSDMA Protein, GST-tagged | +Inquiry |
GSDMA-3014C | Recombinant Chicken GSDMA | +Inquiry |
GSDMA-3951M | Recombinant Mouse GSDMA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMA-5727HCL | Recombinant Human GSDMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSDMA Products
Required fields are marked with *
My Review for All GSDMA Products
Required fields are marked with *