Recombinant Human GSDMA Protein, GST-tagged
| Cat.No. : | GSDMA-4390H |
| Product Overview : | Human GSDMA full-length ORF (BAC04790.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GSDMA (Gasdermin A) is a Protein Coding gene. Diseases associated with GSDMA include Retinitis Pigmentosa 23. An important paralog of this gene is GSDMC. |
| Molecular Mass : | 75.8 kDa |
| AA Sequence : | MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSHLQQLTKAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GSDMA gasdermin A [ Homo sapiens ] |
| Official Symbol | GSDMA |
| Synonyms | GSDMA; gasdermin A; gasdermin , gasdermin 1 , GSDM, GSDM1; gasdermin-A; FLJ39120; gasdermin 1; gasdermin-1; GSDM; FKSG9; GSDM1; MGC129596; |
| Gene ID | 284110 |
| mRNA Refseq | NM_178171 |
| Protein Refseq | NP_835465 |
| MIM | 611218 |
| UniProt ID | Q96QA5 |
| ◆ Recombinant Proteins | ||
| Gsdma-1599R | Recombinant Rat Gsdma Protein, His-tagged | +Inquiry |
| GSDMA-1045H | Recombinant Human GSDMA | +Inquiry |
| Gsdma-1598M | Recombinant Mouse Gsdma Protein, His-tagged | +Inquiry |
| GSDMA-813HFL | Recombinant Full Length Human GSDMA Protein, C-Flag-tagged | +Inquiry |
| GSDMA-3014C | Recombinant Chicken GSDMA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSDMA-5727HCL | Recombinant Human GSDMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSDMA Products
Required fields are marked with *
My Review for All GSDMA Products
Required fields are marked with *
