Recombinant Human GSN
| Cat.No. : | GSN-29012TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 673-782 of Human Gelsolin with an N terminal proprietary tag; Predicted MWt 37.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. |
| Molecular Weight : | 37.840kDa inclusive of tags |
| Tissue specificity : | Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVG KDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFE PPSFVGWFLGWDDDYWSVDPLDRAMAELAA |
| Sequence Similarities : | Belongs to the villin/gelsolin family.Contains 6 gelsolin-like repeats. |
| Gene Name | GSN gelsolin [ Homo sapiens ] |
| Official Symbol | GSN |
| Synonyms | GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718; |
| Gene ID | 2934 |
| mRNA Refseq | NM_000177 |
| Protein Refseq | NP_000168 |
| MIM | 137350 |
| Uniprot ID | P06396 |
| Chromosome Location | 9q33 |
| Pathway | Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; |
| Function | actin binding; calcium ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| GSN-29014TH | Recombinant Human GSN | +Inquiry |
| GSN-529H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
| GSN-4097H | Recombinant Human GSN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Gsn-3320M | Recombinant Mouse Gsn Protein, Myc/DDK-tagged | +Inquiry |
| GSN-1028H | Recombinant Human GSN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
| GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
| GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSN-5722HCL | Recombinant Human GSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSN Products
Required fields are marked with *
My Review for All GSN Products
Required fields are marked with *



