Recombinant Human GSN
Cat.No. : | GSN-29012TH |
Product Overview : | Recombinant fragment corresponding to amino acids 673-782 of Human Gelsolin with an N terminal proprietary tag; Predicted MWt 37.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene binds to the "plus" ends of actin monomers and filaments to prevent monomer exchange. The encoded calcium-regulated protein functions in both assembly and disassembly of actin filaments. Defects in this gene are a cause of familial amyloidosis Finnish type (FAF). Multiple transcript variants encoding several different isoforms have been found for this gene. |
Molecular Weight : | 37.840kDa inclusive of tags |
Tissue specificity : | Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVG KDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFE PPSFVGWFLGWDDDYWSVDPLDRAMAELAA |
Sequence Similarities : | Belongs to the villin/gelsolin family.Contains 6 gelsolin-like repeats. |
Gene Name | GSN gelsolin [ Homo sapiens ] |
Official Symbol | GSN |
Synonyms | GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718; |
Gene ID | 2934 |
mRNA Refseq | NM_000177 |
Protein Refseq | NP_000168 |
MIM | 137350 |
Uniprot ID | P06396 |
Chromosome Location | 9q33 |
Pathway | Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; |
Function | actin binding; calcium ion binding; protein binding; |
◆ Recombinant Proteins | ||
GSN-2220H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-2345H | Recombinant Human GSN Protein (Met433-Ala782), N-His tagged | +Inquiry |
GSN-29012TH | Recombinant Human GSN | +Inquiry |
GSN-529H | Recombinant Human GSN Protein, His-tagged | +Inquiry |
GSN-527C | Recombinant Cattle GSN Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSN-5722HCL | Recombinant Human GSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSN Products
Required fields are marked with *
My Review for All GSN Products
Required fields are marked with *
0
Inquiry Basket