"GSN" Related Products

Expand
Expand

Recombinant Human GSN protein, T7/His-tagged

Cat.No.: GSN-201H
Product Overview: Recombinant human GSN (730 aa, Isoform-b, derived from BC026033) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT .
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFDVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVIL KTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVA SGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIR DNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQ GALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRD PDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDS YIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYK GGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLR VLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDV MLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPL DRAMAELAA
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: GSN gelsolin [ Homo sapiens ]
Official Symbol: GSN
Synonyms: GSN; gelsolin; gelsolin (amyloidosis, Finnish type); amyloidosis; Finnish type; DKFZp313L0718; brevin; actin-depolymerizing factor; ADF; AGEL;
Gene ID: 2934
mRNA Refseq: NM_000177
Protein Refseq: NP_000168
MIM: 137350
UniProt ID: P06396
Chromosome Location: 9q33
Pathway: Amyloids, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem;
Function: actin binding; calcium ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.