Recombinant Human GSPT1 protein, GST-tagged
Cat.No. : | GSPT1-938H |
Product Overview : | Recombinant Human GSPT1(1 a.a. - 633 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-633 a.a. |
Description : | GSPT1 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 94.8 kDa |
AA Sequence : | MDPGSGGGGGGGGSSSGSSSSDSAPDCWDQADMEAPGPGPCGGGGSLAAAAEAQRENLSAAFSRQLNVNAKPFVP NVHAAEFVPSFLRCPAAPPPPAGGAANNHGAGSGAGGRAAPVESSQEEQSLCEGSNSAVSMELSEPIENGETEMS PEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIG GQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFV PNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKL VPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTV VLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGR TFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLE TFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GSPT1 G1 to S phase transition 1 [ Homo sapiens ] |
Official Symbol | GSPT1 |
Synonyms | GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067; |
Gene ID | 2935 |
mRNA Refseq | NM_001130006 |
Protein Refseq | NP_001123478 |
MIM | 139259 |
UniProt ID | P15170 |
Chromosome Location | 16p13.1 |
Pathway | mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem; |
Function | GTP binding; GTPase activity; nucleotide binding; protein binding; translation release factor activity; |
◆ Recombinant Proteins | ||
GSPT1-3873C | Recombinant Chicken GSPT1 | +Inquiry |
GSPT1-941H | Recombinant Human GSPT1 protein, His-tagged | +Inquiry |
GSPT1-939H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-909H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-940H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GSPT1-12HFL | Recombinant Full Length Human GSPT1 Protein, Avi tagged, Biotin Labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *
0
Inquiry Basket