Recombinant Human GSPT1 protein, GST-tagged

• Cat.No.: GSPT1-939H
• Product Overview: Recombinant Human GSPT1 protein(P15170-1)(131-499 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: QEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
• Purity: 70%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GSPT1 G1 to S phase transition 1 [ Homo sapiens ]
• Official Symbol: GSPT1
• Synonyms: GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067
• Gene ID: 2935
• mRNA Refseq: NM_001130006
• Protein Refseq: NP_001123478
• MIM: 139259
• UniProt ID: P15170