Recombinant Human GSPT1 protein, GST-tagged
| Cat.No. : | GSPT1-939H |
| Product Overview : | Recombinant Human GSPT1 protein(P15170-1)(131-499 aa), fused with GST tag, was expressed in E.coli. |
| Availability | June 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | QEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
| Purity : | 70%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GSPT1 G1 to S phase transition 1 [ Homo sapiens ] |
| Official Symbol | GSPT1 |
| Synonyms | GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067; |
| Gene ID | 2935 |
| mRNA Refseq | NM_001130006 |
| Protein Refseq | NP_001123478 |
| MIM | 139259 |
| UniProt ID | P15170 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *
