Recombinant Human GSPT1 protein, GST-tagged

Cat.No. : GSPT1-939H
Product Overview : Recombinant Human GSPT1 protein(P15170-1)(131-499 aa), fused with GST tag, was expressed in E.coli.
Availability June 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : QEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Purity : 70%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GSPT1 G1 to S phase transition 1 [ Homo sapiens ]
Official Symbol GSPT1
Synonyms GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067;
Gene ID 2935
mRNA Refseq NM_001130006
Protein Refseq NP_001123478
MIM 139259
UniProt ID P15170

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSPT1 Products

Required fields are marked with *

My Review for All GSPT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon