Recombinant Human GSPT1 protein, GST-tagged
Cat.No. : | GSPT1-939H |
Product Overview : | Recombinant Human GSPT1 protein(265-633 aa), fused with GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 265-633 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | QEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
Purity : | 70%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GSPT1 G1 to S phase transition 1 [ Homo sapiens ] |
Official Symbol | GSPT1 |
Synonyms | GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067; |
Gene ID | 2935 |
mRNA Refseq | NM_001130006 |
Protein Refseq | NP_001123478 |
MIM | 139259 |
UniProt ID | P15170 |
◆ Recombinant Proteins | ||
GSPT1-940H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-1191Z | Recombinant Zebrafish GSPT1 | +Inquiry |
GSPT1-6788H | Recombinant Human GSPT1 protein, His-tagged | +Inquiry |
GSPT1-2473H | Recombinant Human GSPT1 Protein (1-499 aa), His-Myc-tagged | +Inquiry |
GSPT1-2225H | Recombinant Human GSPT1 protein, MBP&His-tagged | +Inquiry |
◆ Native Proteins | ||
GSPT1-12HFL | Recombinant Full Length Human GSPT1 Protein, Avi tagged, Biotin Labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *
0
Inquiry Basket