Recombinant Human GSTA3, GST-tagged

Cat.No. : GSTA3-27543TH
Product Overview : Recombinant full length Human GSTA3 with N terminal proprietary tag. Predicted MW 50.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 222 amino acids
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined.
Conjugation : GST
Molecular Weight : 50.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAED LGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYN LYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISL VELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF
Sequence Similarities : Belongs to the GST superfamily. Alpha family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ]
Official Symbol GSTA3
Synonyms GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3;
Gene ID 2940
mRNA Refseq NM_000847
Protein Refseq NP_000838
MIM 605449
Uniprot ID Q16772
Chromosome Location 6p12.2
Pathway Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function glutathione transferase activity; glutathione transferase activity; glutathione transferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTA3 Products

Required fields are marked with *

My Review for All GSTA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon