Recombinant Human GSTK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GSTK1-4427H
Product Overview : GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.
Molecular Mass : 25.5 kDa
AA Sequence : MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GSTK1 glutathione S-transferase kappa 1 [ Homo sapiens (human) ]
Official Symbol GSTK1
Synonyms GSTK1; glutathione S-transferase kappa 1; GST13; GST class-kappa; glutathione S-transferase k1; glutathione S-transferase subunit 13 homolog; GST; hGSTK1; GSTK1-1; GST13-13; GST 13-13;
Gene ID 373156
mRNA Refseq NM_015917
Protein Refseq NP_057001
MIM 602321
UniProt ID Q9Y2Q3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTK1 Products

Required fields are marked with *

My Review for All GSTK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon