Recombinant Human GSTK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GSTK1-4427H |
Product Overview : | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GSTK1 glutathione S-transferase kappa 1 [ Homo sapiens (human) ] |
Official Symbol | GSTK1 |
Synonyms | GSTK1; glutathione S-transferase kappa 1; GST13; GST class-kappa; glutathione S-transferase k1; glutathione S-transferase subunit 13 homolog; GST; hGSTK1; GSTK1-1; GST13-13; GST 13-13; |
Gene ID | 373156 |
mRNA Refseq | NM_015917 |
Protein Refseq | NP_057001 |
MIM | 602321 |
UniProt ID | Q9Y2Q3 |
◆ Recombinant Proteins | ||
GSTK1-1991R | Recombinant Rhesus monkey GSTK1 Protein, His-tagged | +Inquiry |
GSTK1-2780H | Recombinant Human GSTK1 Protein (Thr7-Val222), N-His tagged | +Inquiry |
GSTK1-9133HFL | Recombinant Full Length Human GSTK1, Flag-tagged | +Inquiry |
GSTK1-3971M | Recombinant Mouse GSTK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gstk1-1490R | Recombinant Rat Gstk1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTK1-5714HCL | Recombinant Human GSTK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSTK1 Products
Required fields are marked with *
My Review for All GSTK1 Products
Required fields are marked with *
0
Inquiry Basket