Recombinant Human GSTM3 protein, His-tagged
| Cat.No. : | GSTM3-3402H |
| Product Overview : | Recombinant Human GSTM3 protein(1-225 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-225 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GSTM3 glutathione S-transferase mu 3 (brain) [ Homo sapiens ] |
| Official Symbol | GSTM3 |
| Synonyms | GSTM3; glutathione S-transferase mu 3 (brain); glutathione S transferase M3 (brain); glutathione S-transferase Mu 3; GST5; hGSTM3-3; brain GST; GST class-mu 3; glutathione S-transferase, Mu-3; glutathione S-aryltransferase M3; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; S-(hydroxyalkyl)glutathione lyase M3; glutathione S-transferase M3 (brain); brain type mu-glutathione S-transferase; GSTB; GTM3; GSTM3-3; MGC3310; MGC3704; |
| Gene ID | 2947 |
| mRNA Refseq | NM_000849 |
| Protein Refseq | NP_000840 |
| MIM | 138390 |
| UniProt ID | P21266 |
| ◆ Recombinant Proteins | ||
| GSTM3-322C | Recombinant Cynomolgus Monkey GSTM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSTM3-576C | Recombinant Cynomolgus GSTM3 Protein, His-tagged | +Inquiry |
| GSTM3-7542Z | Recombinant Zebrafish GSTM3 | +Inquiry |
| GSTM3-664H | Recombinant Human GSTM3 protein, His & T7-tagged | +Inquiry |
| GSTM3-1814R | Recombinant Rhesus Macaque GSTM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTM3-759HCL | Recombinant Human GSTM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTM3 Products
Required fields are marked with *
My Review for All GSTM3 Products
Required fields are marked with *



