Recombinant Human GSTM3 protein, His-tagged
Cat.No. : | GSTM3-3402H |
Product Overview : | Recombinant Human GSTM3 protein(1-225 aa), fused to His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-225 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GSTM3 glutathione S-transferase mu 3 (brain) [ Homo sapiens ] |
Official Symbol | GSTM3 |
Synonyms | GSTM3; glutathione S-transferase mu 3 (brain); glutathione S transferase M3 (brain); glutathione S-transferase Mu 3; GST5; hGSTM3-3; brain GST; GST class-mu 3; glutathione S-transferase, Mu-3; glutathione S-aryltransferase M3; glutathione S-alkyltransferase M3; glutathione S-aralkyltransferase M3; S-(hydroxyalkyl)glutathione lyase M3; glutathione S-transferase M3 (brain); brain type mu-glutathione S-transferase; GSTB; GTM3; GSTM3-3; MGC3310; MGC3704; |
Gene ID | 2947 |
mRNA Refseq | NM_000849 |
Protein Refseq | NP_000840 |
MIM | 138390 |
UniProt ID | P21266 |
◆ Recombinant Proteins | ||
GSTM3-4419H | Recombinant Human GSTM3 Protein, GST-tagged | +Inquiry |
GSTM3-12H | Active Recombinant Human GSTM3 Protein (1-225aa), N-His tagged | +Inquiry |
GSTM3-2555H | Recombinant Human GSTM3 Protein (Val8-Pro223), N-His tagged | +Inquiry |
Gstm3-675M | Recombinant Mouse Gstm3 protein, His&Myc-tagged | +Inquiry |
GSTM3-3974M | Recombinant Mouse GSTM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM3-759HCL | Recombinant Human GSTM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTM3 Products
Required fields are marked with *
My Review for All GSTM3 Products
Required fields are marked with *