Recombinant Human GSTO1 protein, GST-tagged
Cat.No. : | GSTO1-3680H |
Product Overview : | Recombinant Human GSTO1 protein(1-241 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-241 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GSTO1 glutathione S-transferase omega 1 [ Homo sapiens ] |
Official Symbol | GSTO1 |
Synonyms | GSTO1; glutathione S-transferase omega 1; glutathione S-transferase omega-1; GSTTLp28; P28; GSTO-1; MMA(V) reductase; glutathione-S-transferase like; monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; glutathione S-transferase omega 1-1; glutathione-dependent dehydroascorbate reductase; SPG-R; GSTO 1-1; DKFZp686H13163; |
Gene ID | 9446 |
mRNA Refseq | NM_001191002 |
Protein Refseq | NP_001177931 |
MIM | 605482 |
UniProt ID | P78417 |
◆ Recombinant Proteins | ||
GSTO1-3680H | Recombinant Human GSTO1 protein, GST-tagged | +Inquiry |
GSTO1-1995R | Recombinant Rhesus monkey GSTO1 Protein, His-tagged | +Inquiry |
GSTO1-7337M | Recombinant Mouse GSTO1 Protein | +Inquiry |
GSTO1-28119TH | Recombinant Human GSTO1, His-tagged | +Inquiry |
GSTO1-3978M | Recombinant Mouse GSTO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO1-761HCL | Recombinant Human GSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSTO1 Products
Required fields are marked with *
My Review for All GSTO1 Products
Required fields are marked with *
0
Inquiry Basket