Recombinant Human GSTO1 protein, GST-tagged

Cat.No. : GSTO1-3680H
Product Overview : Recombinant Human GSTO1 protein(1-241 aa), fused to GST tag, was expressed in E. coli.
Availability May 23, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-241 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GSTO1 glutathione S-transferase omega 1 [ Homo sapiens ]
Official Symbol GSTO1
Synonyms GSTO1; glutathione S-transferase omega 1; glutathione S-transferase omega-1; GSTTLp28; P28; GSTO-1; MMA(V) reductase; glutathione-S-transferase like; monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; glutathione S-transferase omega 1-1; glutathione-dependent dehydroascorbate reductase; SPG-R; GSTO 1-1; DKFZp686H13163;
Gene ID 9446
mRNA Refseq NM_001191002
Protein Refseq NP_001177931
MIM 605482
UniProt ID P78417

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTO1 Products

Required fields are marked with *

My Review for All GSTO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon