Recombinant Human GSTP1 protein, GST-tagged
| Cat.No. : | GSTP1-1215H |
| Product Overview : | Recombinant Human GSTP1 protein(1-210 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-210 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ] |
| Official Symbol | GSTP1 |
| Synonyms | GSTP1; glutathione S-transferase pi 1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; deafness, X-linked 7; fatty acid ethyl ester synthase III; PI; DFN7; GST3; FAEES3; |
| Gene ID | 2950 |
| mRNA Refseq | NM_000852 |
| Protein Refseq | NP_000843 |
| MIM | 134660 |
| UniProt ID | P09211 |
| ◆ Recombinant Proteins | ||
| GSTP1-7786H | Recombinant Human GSTP1 protein, His-tagged | +Inquiry |
| GSTP1-1491C | Recombinant Cattle GSTP1 protein, His-tagged | +Inquiry |
| GSTP1-540M | Recombinant Mouse GSTP1 Protein (2-210 aa), His-SUMO-tagged | +Inquiry |
| GSTP1-7339M | Recombinant Mouse GSTP1 Protein | +Inquiry |
| GSTP1-1032H | Recombinant Human GSTP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *
