Recombinant Human GSTP1 protein, GST-tagged
Cat.No. : | GSTP1-1215H |
Product Overview : | Recombinant Human GSTP1 protein(1-210 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-210 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens ] |
Official Symbol | GSTP1 |
Synonyms | GSTP1; glutathione S-transferase pi 1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; deafness, X-linked 7; fatty acid ethyl ester synthase III; PI; DFN7; GST3; FAEES3; |
Gene ID | 2950 |
mRNA Refseq | NM_000852 |
Protein Refseq | NP_000843 |
MIM | 134660 |
UniProt ID | P09211 |
◆ Recombinant Proteins | ||
GSTP1-3002H | Recombinant Human GSTP1 protein, GST-tagged | +Inquiry |
GSTP1-7339M | Recombinant Mouse GSTP1 Protein | +Inquiry |
GSTP1-2999C | Recombinant Chinese hamster GSTP1 protein, His&Myc-tagged | +Inquiry |
Gstp1-3003R | Recombinant Rat Gstp1 protein, His-tagged | +Inquiry |
GSTP1-1215H | Recombinant Human GSTP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *
0
Inquiry Basket