Recombinant Human GSTP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GSTP1-3999H |
Product Overview : | GSTP1 MS Standard C13 and N15-labeled recombinant protein (NP_000843) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GSTP1 glutathione S-transferase pi 1 [ Homo sapiens (human) ] |
Official Symbol | GSTP1 |
Synonyms | GSTP1; glutathione S-transferase pi 1; FAEES3, GST3; glutathione S-transferase P; GSTP; GSTP1-1; GST class-pi; deafness, X-linked 7; fatty acid ethyl ester synthase III; PI; DFN7; GST3; FAEES3; |
Gene ID | 2950 |
mRNA Refseq | NM_000852 |
Protein Refseq | NP_000843 |
MIM | 134660 |
UniProt ID | P09211 |
◆ Recombinant Proteins | ||
Gstp1-3003R | Recombinant Rat Gstp1 protein, His-tagged | +Inquiry |
GSTP1-22H | Active Recombinant Human GSTP1 Protein (1-210aa), N-His tagged | +Inquiry |
Gstp1-1493R | Recombinant Rat Gstp1 protein, His-tagged | +Inquiry |
GSTP1-1818R | Recombinant Rhesus Macaque GSTP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTP1-250H | Active Recombinant Human GSTP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTP1-5709HCL | Recombinant Human GSTP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTP1 Products
Required fields are marked with *
My Review for All GSTP1 Products
Required fields are marked with *