Recombinant Human GSTT2 Protein, GST-tagged
Cat.No. : | GSTT2-4430H |
Product Overview : | Human GSTT2 full-length ORF ( AAH02415, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glutathione S-transferase (GSTs) theta 2 (GSTT2) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: Alpha, Mu, Pi, Theta, and Zeta. The theta class members GSTT1 and GSTT2 share 55% amino acid sequence identity and both are thought to have an important role in human carcinogenesis. The theta genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq |
Molecular Mass : | 52.58 kDa |
AA Sequence : | MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSTT2 glutathione S-transferase theta 2 [ Homo sapiens ] |
Official Symbol | GSTT2 |
Synonyms | GSTT2; glutathione S-transferase theta 2; glutathione S-transferase theta-2; GST class-theta-2; Glutathione S-transferase theta-2B; GSTT2B; MGC182032; |
Gene ID | 2953 |
mRNA Refseq | NM_000854 |
Protein Refseq | NP_000845 |
MIM | 600437 |
UniProt ID | P0CG29 |
◆ Recombinant Proteins | ||
Gstt2-2667R | Recombinant Rat Gstt2 protein, His & T7-tagged | +Inquiry |
GSTT2-3982M | Recombinant Mouse GSTT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTT2-2665H | Recombinant Human GSTT2 protein, His & T7-tagged | +Inquiry |
GSTT2-5353H | Recombinant Human GSTT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GSTT2-327C | Recombinant Cynomolgus Monkey GSTT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTT2-5708HCL | Recombinant Human GSTT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTT2 Products
Required fields are marked with *
My Review for All GSTT2 Products
Required fields are marked with *
0
Inquiry Basket