Recombinant Human GSTT2B

• Cat.No.: GSTT2B-26090TH
• Product Overview: Recombinant fragment of Human Glutathione S Transferase theta 2 with N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
• Sequence Similarities: Belongs to the GST superfamily. Theta family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.

Gene Information

• Gene Name: GSTT2B glutathione S-transferase theta 2B (gene/pseudogene) [ Homo sapiens ]
• Official Symbol: GSTT2B
• Synonyms: GSTT2B; glutathione S-transferase theta 2B (gene/pseudogene); glutathione S-transferase theta-2B; GSTT2P
• Gene ID: 653689
• mRNA Refseq: NM_001080843
• Protein Refseq: NP_001074312
• Uniprot ID: P0CG30
• Chromosome Location: 22q11.23
• Pathway: Glutathione metabolism, organism-specific biosystem; Oxidative Stress, organism-specific biosystem
• Function: glutathione transferase activity; transferase activity