Recombinant Human GSTT2B

Cat.No. : GSTT2B-26090TH
Product Overview : Recombinant fragment of Human Glutathione S Transferase theta 2 with N terminal proprietary tag; Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Sequence Similarities : Belongs to the GST superfamily. Theta family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name GSTT2B glutathione S-transferase theta 2B (gene/pseudogene) [ Homo sapiens ]
Official Symbol GSTT2B
Synonyms GSTT2B; glutathione S-transferase theta 2B (gene/pseudogene); glutathione S-transferase theta-2B; GSTT2P;
Gene ID 653689
mRNA Refseq NM_001080843
Protein Refseq NP_001074312
Uniprot ID P0CG30
Chromosome Location 22q11.23
Pathway Glutathione metabolism, organism-specific biosystem; Oxidative Stress, organism-specific biosystem;
Function glutathione transferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GSTT2B Products

Required fields are marked with *

My Review for All GSTT2B Products

Required fields are marked with *

0
cart-icon