Recombinant Human GSTZ1 protein, GST-tagged
| Cat.No. : | GSTZ1-13585H | 
| Product Overview : | Recombinant Human N-terminal GSTZ1 protein(1-216 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-216 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
| AASequence : | MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | GSTZ1 glutathione transferase zeta 1 [ Homo sapiens ] | 
| Official Symbol | GSTZ1 | 
| Synonyms | GSTZ1; glutathione transferase zeta 1; maleylacetoacetate isomerase; GSTZ1 1; MAAI; MAI; maleylacetone isomerase; glutathione S-aryltransferase; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione s-transferase Zeta 1; S-(hydroxyalkyl)glutathione lyase; GSTZ1-1; MGC2029; | 
| Gene ID | 2954 | 
| mRNA Refseq | NM_001513 | 
| Protein Refseq | NP_001504 | 
| MIM | 603758 | 
| UniProt ID | O43708 | 
| ◆ Recombinant Proteins | ||
| GSTZ1-582C | Recombinant Cynomolgus GSTZ1 Protein, His-tagged | +Inquiry | 
| GSTZ1-4432H | Recombinant Human GSTZ1 Protein, GST-tagged | +Inquiry | 
| GSTZ1-2157H | Recombinant Human GSTZ1 protein, His-tagged | +Inquiry | 
| GSTZ1-2736R | Recombinant Rat GSTZ1 Protein | +Inquiry | 
| GSTZ1-609Z | Recombinant Zebrafish GSTZ1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GSTZ1-5707HCL | Recombinant Human GSTZ1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTZ1 Products
Required fields are marked with *
My Review for All GSTZ1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            