Recombinant Human GTF2A2 protein, GST-tagged
| Cat.No. : | GTF2A2-3004H |
| Product Overview : | Recombinant Human GTF2A2 protein(P52657)(1-109aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-109aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.5 kDa |
| AA Sequence : | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GTF2A2 general transcription factor IIA, 2, 12kDa [ Homo sapiens ] |
| Official Symbol | GTF2A2 |
| Synonyms | GTF2A2; general transcription factor IIA, 2, 12kDa; general transcription factor IIA, 2 (12kD subunit); transcription initiation factor IIA subunit 2; HsT18745; TFIIA; TFIIAS; TFIIA-12; TFIIA-gamma; TFIIA p12 subunit; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain; TF2A2; |
| Gene ID | 2958 |
| mRNA Refseq | NM_004492 |
| Protein Refseq | NP_004483 |
| MIM | 600519 |
| UniProt ID | P52657 |
| ◆ Recombinant Proteins | ||
| GTF2A2-2785Z | Recombinant Zebrafish GTF2A2 | +Inquiry |
| GTF2A2-2001R | Recombinant Rhesus monkey GTF2A2 Protein, His-tagged | +Inquiry |
| GTF2A2-3004H | Recombinant Human GTF2A2 protein, GST-tagged | +Inquiry |
| GTF2A2-3374HF | Recombinant Full Length Human GTF2A2 Protein, GST-tagged | +Inquiry |
| GTF2A2-3000H | Recombinant Human General Transcription Factor IIA, 2, 12kDa, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTF2A2-5704HCL | Recombinant Human GTF2A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2A2 Products
Required fields are marked with *
My Review for All GTF2A2 Products
Required fields are marked with *
