Recombinant Human GTF2A2 protein, GST-tagged

Cat.No. : GTF2A2-3004H
Product Overview : Recombinant Human GTF2A2 protein(P52657)(1-109aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-109aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.5 kDa
AA Sequence : MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GTF2A2 general transcription factor IIA, 2, 12kDa [ Homo sapiens ]
Official Symbol GTF2A2
Synonyms GTF2A2; general transcription factor IIA, 2, 12kDa; general transcription factor IIA, 2 (12kD subunit); transcription initiation factor IIA subunit 2; HsT18745; TFIIA; TFIIAS; TFIIA-12; TFIIA-gamma; TFIIA p12 subunit; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain; TF2A2;
Gene ID 2958
mRNA Refseq NM_004492
Protein Refseq NP_004483
MIM 600519
UniProt ID P52657

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2A2 Products

Required fields are marked with *

My Review for All GTF2A2 Products

Required fields are marked with *

0
cart-icon