Recombinant Human GTF2F1 protein(111-280 aa), C-His-tagged
Cat.No. : | GTF2F1-2735H |
Product Overview : | Recombinant Human GTF2F1 protein(P35269)(111-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111-280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS |
Gene Name | GTF2F1 general transcription factor IIF, polypeptide 1, 74kDa [ Homo sapiens ] |
Official Symbol | GTF2F1 |
Synonyms | GTF2F1; general transcription factor IIF, polypeptide 1, 74kDa; general transcription factor IIF, polypeptide 1 (74kD subunit); general transcription factor IIF subunit 1; BTF4; RAP74; TF2F1; TFIIF; TFIIF-alpha; transcription initiation factor RAP74; general transcription factor IIF 74 kDa subunit; transcription initiation factor IIF subunit alpha; |
Gene ID | 2962 |
mRNA Refseq | NM_002096 |
Protein Refseq | NP_002087 |
MIM | 189968 |
UniProt ID | P35269 |
◆ Recombinant Proteins | ||
GTF2F1-2005R | Recombinant Rhesus monkey GTF2F1 Protein, His-tagged | +Inquiry |
GTF2F1-2742R | Recombinant Rat GTF2F1 Protein | +Inquiry |
GTF2F1-665H | Recombinant Human GTF2F1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GTF2F1-8457H | Active Recombinant Human GTF2F1, His-tagged | +Inquiry |
GTF2F1-13593H | Recombinant Human GTF2F1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2F1-5700HCL | Recombinant Human GTF2F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2F1 Products
Required fields are marked with *
My Review for All GTF2F1 Products
Required fields are marked with *
0
Inquiry Basket