Recombinant Human GTF2H4

• Cat.No.: GTF2H4-28282TH
• Product Overview: Recombinant fragment of Human GTF2H4 with N terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: General transcription factor IIH subunit 4 is a protein that in humans is encoded by the GTF2H4 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
• Sequence Similarities: Belongs to the TFB2 family.

Gene Information

• Gene Name: GTF2H4 general transcription factor IIH, polypeptide 4, 52kDa [ Homo sapiens ]
• Official Symbol: GTF2H4
• Synonyms: GTF2H4; general transcription factor IIH, polypeptide 4, 52kDa; general transcription factor IIH, polypeptide 4 (52kD subunit); general transcription factor IIH subunit 4; TFB2; TFIIH
• Gene ID: 2968
• mRNA Refseq: NM_001517
• Protein Refseq: NP_001508
• MIM: 601760
• Uniprot ID: Q92759
• Chromosome Location: 6p21.3
• Pathway: Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem
• Function: contributes_to DNA-dependent ATPase activity; contributes_to RNA polymerase II carboxy-terminal domain kinase activity; protein binding; contributes_to protein kinase activity; sequence-specific DNA binding transcription factor activity