Recombinant Human GTF2H4
| Cat.No. : | GTF2H4-28282TH |
| Product Overview : | Recombinant fragment of Human GTF2H4 with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | General transcription factor IIH subunit 4 is a protein that in humans is encoded by the GTF2H4 gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS |
| Sequence Similarities : | Belongs to the TFB2 family. |
| Gene Name | GTF2H4 general transcription factor IIH, polypeptide 4, 52kDa [ Homo sapiens ] |
| Official Symbol | GTF2H4 |
| Synonyms | GTF2H4; general transcription factor IIH, polypeptide 4, 52kDa; general transcription factor IIH, polypeptide 4 (52kD subunit); general transcription factor IIH subunit 4; TFB2; TFIIH; |
| Gene ID | 2968 |
| mRNA Refseq | NM_001517 |
| Protein Refseq | NP_001508 |
| MIM | 601760 |
| Uniprot ID | Q92759 |
| Chromosome Location | 6p21.3 |
| Pathway | Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; |
| Function | contributes_to DNA-dependent ATPase activity; contributes_to RNA polymerase II carboxy-terminal domain kinase activity; protein binding; contributes_to protein kinase activity; sequence-specific DNA binding transcription factor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2H4 Products
Required fields are marked with *
My Review for All GTF2H4 Products
Required fields are marked with *
