Recombinant Human GTF2H4

Cat.No. : GTF2H4-28282TH
Product Overview : Recombinant fragment of Human GTF2H4 with N terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : General transcription factor IIH subunit 4 is a protein that in humans is encoded by the GTF2H4 gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
Sequence Similarities : Belongs to the TFB2 family.
Gene Name GTF2H4 general transcription factor IIH, polypeptide 4, 52kDa [ Homo sapiens ]
Official Symbol GTF2H4
Synonyms GTF2H4; general transcription factor IIH, polypeptide 4, 52kDa; general transcription factor IIH, polypeptide 4 (52kD subunit); general transcription factor IIH subunit 4; TFB2; TFIIH;
Gene ID 2968
mRNA Refseq NM_001517
Protein Refseq NP_001508
MIM 601760
Uniprot ID Q92759
Chromosome Location 6p21.3
Pathway Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem;
Function contributes_to DNA-dependent ATPase activity; contributes_to RNA polymerase II carboxy-terminal domain kinase activity; protein binding; contributes_to protein kinase activity; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2H4 Products

Required fields are marked with *

My Review for All GTF2H4 Products

Required fields are marked with *

0
cart-icon