Recombinant Human GTF2H5 Protein, GST-tagged
| Cat.No. : | GTF2H5-4453H |
| Product Overview : | Human GTF2H5 full-length ORF ( NP_997001.1, 1 a.a. - 71 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a subunit of transcription/repair factor TFIIH, which functions in gene transcription and DNA repair. This protein stimulates ERCC3/XPB ATPase activity to trigger DNA opening during DNA repair, and is implicated in regulating cellular levels of TFIIH. Mutations in this gene result in trichothiodystrophy, complementation group A. [provided by RefSeq, Mar 2009] |
| Molecular Mass : | 34.5 kDa |
| AA Sequence : | MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GTF2H5 general transcription factor IIH subunit 5 [ Homo sapiens (human) ] |
| Official Symbol | GTF2H5 |
| Synonyms | GTF2H5; general transcription factor IIH subunit 5; TTD; TFB5; TTD3; TTDA; TFIIH; TTD-A; TGF2H5; C6orf175; bA120J8.2; general transcription factor IIH subunit 5; TFB5 ortholog; TFIIH basal transcription factor complex TTD-A subunit; TFIIH basal transcription factor complex TTDA subunit; general transcription factor IIH, polypeptide 5; General Transcription Factor IIH Subunit 5; TFIIH Basal Transcription Factor Complex TTD-A Subunit; General Transcription Factor IIH, Polypeptide 5; TFB5 Ortholog; TFIIH Basal Transcription Factor Complex TTDA Subunit; DNA Repair Syndrome Trichothiodystrophy Group A; General Transcription Factor IIH Polypeptide 5; Chromosome 6 Open Reading Frame 175 |
| Gene ID | 404672 |
| mRNA Refseq | NM_207118 |
| Protein Refseq | NP_997001 |
| MIM | 608780 |
| UniProt ID | Q6ZYL4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2H5 Products
Required fields are marked with *
My Review for All GTF2H5 Products
Required fields are marked with *
