Recombinant Human GTF2H5 protein, His-tagged
Cat.No. : | GTF2H5-7843H |
Product Overview : | Recombinant Human GTF2H5 protein(1-42 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-42 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTH |
Gene Name | GTF2H5 general transcription factor IIH subunit 5 [ Homo sapiens (human) ] |
Official Symbol | GTF2H5 |
Synonyms | TTD; TFB5; TTD3; TTDA; TFIIH; TTD-A; TGF2H5; C6orf175; bA120J8.2; GTF2H5 |
Gene ID | 404672 |
mRNA Refseq | NM_207118 |
Protein Refseq | NP_997001 |
MIM | 608780 |
UniProt ID | Q0P5V8 |
◆ Recombinant Proteins | ||
GTF2H5-2583H | Recombinant Human GTF2H5 protein, His-tagged | +Inquiry |
GTF2H5-7843H | Recombinant Human GTF2H5 protein, His-tagged | +Inquiry |
Gtf2h5-3327M | Recombinant Mouse Gtf2h5 Protein, Myc/DDK-tagged | +Inquiry |
GTF2H5-8037Z | Recombinant Zebrafish GTF2H5 | +Inquiry |
GTF2H5-7170Z | Recombinant Zebrafish GTF2H5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2H5-5693HCL | Recombinant Human GTF2H5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTF2H5 Products
Required fields are marked with *
My Review for All GTF2H5 Products
Required fields are marked with *
0
Inquiry Basket