Recombinant Human GTF2H5 protein, His-tagged
| Cat.No. : | GTF2H5-7843H |
| Product Overview : | Recombinant Human GTF2H5 protein(1-42 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-42 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTH |
| Gene Name | GTF2H5 general transcription factor IIH subunit 5 [ Homo sapiens (human) ] |
| Official Symbol | GTF2H5 |
| Synonyms | TTD; TFB5; TTD3; TTDA; TFIIH; TTD-A; TGF2H5; C6orf175; bA120J8.2; GTF2H5 |
| Gene ID | 404672 |
| mRNA Refseq | NM_207118 |
| Protein Refseq | NP_997001 |
| MIM | 608780 |
| UniProt ID | Q0P5V8 |
| ◆ Recombinant Proteins | ||
| GTF2H5-1830R | Recombinant Rhesus Macaque GTF2H5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GTF2H5-2009R | Recombinant Rhesus monkey GTF2H5 Protein, His-tagged | +Inquiry |
| GTF2H5-3992M | Recombinant Mouse GTF2H5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GTF2H5-7844H | Recombinant Human GTF2H5 protein, GST-tagged | +Inquiry |
| GTF2H5-55H | Recombinant Human GTF2H5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GTF2H5-5693HCL | Recombinant Human GTF2H5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2H5 Products
Required fields are marked with *
My Review for All GTF2H5 Products
Required fields are marked with *



