Recombinant Human GTF3C2 protein, GST-tagged

Cat.No. : GTF3C2-7854H
Product Overview : Recombinant Human GTF3C2 protein(59-188 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 59-188 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name GTF3C2 general transcription factor IIIC, polypeptide 2, beta 110kDa [ Homo sapiens ]
Official Symbol GTF3C2
Synonyms GTF3C2; general transcription factor IIIC, polypeptide 2, beta 110kDa; general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD); general transcription factor 3C polypeptide 2; KIAA0011; TFIIIC110; TF3C-beta; TFIIIC 110 kDa subunit; transcription factor IIIC subunit beta; transcription factor IIIC 110 kDa subunit; TFIIIC-BETA;
mRNA Refseq NM_001035521
Protein Refseq NP_001030598
MIM 604883
UniProt ID Q8WUA4
Gene ID 2976

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF3C2 Products

Required fields are marked with *

My Review for All GTF3C2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon