Recombinant Human GTF3C2 protein, GST-tagged

• Cat.No.: GTF3C2-7854H
• Product Overview: Recombinant Human GTF3C2 protein(59-188 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 59-188 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: GTF3C2 general transcription factor IIIC, polypeptide 2, beta 110kDa [ Homo sapiens ]
• Official Symbol: GTF3C2
• Synonyms: GTF3C2; general transcription factor IIIC, polypeptide 2, beta 110kDa; general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD); general transcription factor 3C polypeptide 2; KIAA0011; TFIIIC110; TF3C-beta; TFIIIC 110 kDa subunit; transcription factor IIIC subunit beta; transcription factor IIIC 110 kDa subunit; TFIIIC-BETA
• mRNA Refseq: NM_001035521
• Protein Refseq: NP_001030598
• MIM: 604883
• UniProt ID: Q8WUA4
• Gene ID: 2976