Recombinant Human GTPBP4 Protein, GST-tagged
Cat.No. : | GTPBP4-4474H |
Product Overview : | Human GTPBP4 full-length ORF ( NP_036473.2, 1 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. Active in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target. [provided by RefSeq |
Molecular Mass : | 100.4 kDa |
AA Sequence : | MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTPBP4 GTP binding protein 4 [ Homo sapiens ] |
Official Symbol | GTPBP4 |
Synonyms | GTPBP4; GTP binding protein 4; nucleolar GTP-binding protein 1; GTP binding protein; CRFG; FLJ10686; FLJ10690; G protein binding protein CRFG; NGB; NOG1; GTP-binding protein NGB; G protein-binding protein CRFG; chronic renal failure gene protein; FLJ39774; |
Gene ID | 23560 |
mRNA Refseq | NM_012341 |
Protein Refseq | NP_036473 |
UniProt ID | Q9BZE4 |
◆ Recombinant Proteins | ||
GTPBP4-7376M | Recombinant Mouse GTPBP4 Protein | +Inquiry |
GTPBP4-1498C | Recombinant Chicken GTPBP4 | +Inquiry |
GTPBP4-10224Z | Recombinant Zebrafish GTPBP4 | +Inquiry |
GTPBP4-4002M | Recombinant Mouse GTPBP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GTPBP4-4474H | Recombinant Human GTPBP4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTPBP4-5684HCL | Recombinant Human GTPBP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTPBP4 Products
Required fields are marked with *
My Review for All GTPBP4 Products
Required fields are marked with *