Recombinant Human GUCA1A
Cat.No. : | GUCA1A-28157TH |
Product Overview : | Recombinant full length Human GCAP1 with a N terminal proprietary tag; Predicted MW 47.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 201 amino acids |
Description : | This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. |
Molecular Weight : | 47.520kDa inclusive of tags |
Tissue specificity : | Retina; cone outer and inner segments, in particular, in disk membrane regions, and to a lesser extent rod inner and outer segments. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFR QFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAAL SLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGV QKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAA G |
Sequence Similarities : | Contains 4 EF-hand domains. |
Gene Name | GUCA1A guanylate cyclase activator 1A (retina) [ Homo sapiens ] |
Official Symbol | GUCA1A |
Synonyms | GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131 , GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1; |
Gene ID | 2978 |
mRNA Refseq | NM_000409 |
Protein Refseq | NP_000400 |
MIM | 600364 |
Uniprot ID | P43080 |
Chromosome Location | 6p21.1 |
Pathway | Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Phototransduction, organism-specific biosystem; Phototransduction, conserved biosystem; Visual signal transduction: Cones, organism-specific biosystem; |
Function | calcium ion binding; calcium sensitive guanylate cyclase activator activity; |
◆ Recombinant Proteins | ||
GUCA1A-226HF | Recombinant Full Length Human GUCA1A Protein | +Inquiry |
GUCA1A-407H | Recombinant Human GUCA1A, Gly & Pro tagged | +Inquiry |
GUCA1A-4482H | Recombinant Human GUCA1A Protein, GST-tagged | +Inquiry |
GUCA1A-9374Z | Recombinant Zebrafish GUCA1A | +Inquiry |
GUCA1A-1746H | Recombinant Human GUCA1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA1A-002HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
GUCA1A-001HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUCA1A Products
Required fields are marked with *
My Review for All GUCA1A Products
Required fields are marked with *
0
Inquiry Basket