Recombinant Human GUCA2B Protein (27-112 aa), His-tagged
| Cat.No. : | GUCA2B-1650H |
| Product Overview : | Recombinant Human GUCA2B Protein (27-112 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-112 aa |
| Description : | Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.5 kDa |
| AA Sequence : | VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens ] |
| Official Symbol | GUCA2B |
| Synonyms | GUCA2B; uroguanylin; UGN; GCAP-II; |
| Gene ID | 2981 |
| mRNA Refseq | NM_007102 |
| Protein Refseq | NP_009033 |
| MIM | 601271 |
| UniProt ID | Q16661 |
| ◆ Recombinant Proteins | ||
| GUCA2B-657M | Recombinant Mouse GUCA2B protein, His-tagged(VLPs) | +Inquiry |
| GUCA2B-2407R | Recombinant Rat GUCA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
| GUCA2B-7386M | Recombinant Mouse GUCA2B Protein | +Inquiry |
| GUCA2B-5393G | Recombinant Guinea pig GUCA2B protein | +Inquiry |
| GUCA2B-3706H | Recombinant Human GUCA2B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GUCA2B-767HCL | Recombinant Human GUCA2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA2B Products
Required fields are marked with *
My Review for All GUCA2B Products
Required fields are marked with *
