Recombinant Human GUCA2B Protein (27-112 aa), His-tagged

Cat.No. : GUCA2B-1650H
Product Overview : Recombinant Human GUCA2B Protein (27-112 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 27-112 aa
Description : Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.5 kDa
AA Sequence : VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens ]
Official Symbol GUCA2B
Synonyms GUCA2B; uroguanylin; UGN; GCAP-II;
Gene ID 2981
mRNA Refseq NM_007102
Protein Refseq NP_009033
MIM 601271
UniProt ID Q16661

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCA2B Products

Required fields are marked with *

My Review for All GUCA2B Products

Required fields are marked with *

0
cart-icon
0
compare icon