"GUF1" Related Products

Recombinant Human GUF1 protein, GST-tagged

Cat.No.: GUF1-185H
Product Overview: Recombinant Human GUF1(1 a.a. - 645 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: GUF1 played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 98 kDa
AA Sequence: MWTLVGRGWGCARALAPRATGAALLVAPGPRSAPTLGAAPESWATDRLYSSAEFKEKPDMSRFPVENIRNFSIVA HVDHGKSTLADRLLELTGTIDKTKNNKQVLDKLQVERERGITVKAQTASLFYNCEGKQYLLNLIDTPGHVDFSYE VSRSLSACQGVLLVVDANEGIQAQTVANFFLAFEAQLSVIPVINKIDLKNADPERVENQIEKVFDIPSDECIKIS AKLGTNVESVLQAIIERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVVSKGDKIVSAHTQKTYEVNEV GVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHKQPVEPLPGFKSAKPMVFAGMYPLDQSEYNNLKSA IEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQRLEQEYNASVILTTPTVPYKAVLSSSKLIKEHREK EITIINPAQFPDKSKVTEYLEPVVLGTIITPDEYTGKIMMLCEARRAVQKNMIFIDQNRVMLKYLFPLNEIVVDF YDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQ AAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKRQAEGKKS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: GUF1 GUF1 GTPase homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: GUF1
Synonyms: GUF1; GUF1 GTPase homolog (S. cerevisiae); translation factor GUF1, mitochondrial; FLJ13220; GTPase GUF1; ribosomal back-translocase; elongation factor 4 homolog; GTPase of unknown function 1; GTP-binding protein GUF1 homolog; EF-4;
Gene ID: 60558
mRNA Refseq: NM_021927
Protein Refseq: NP_068746
MIM:
UniProt ID: Q8N442
Chromosome Location: 4p13
Function: GTP binding; GTPase activity; hydrolase activity; nucleotide binding;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.