Recombinant Human GULP1 Protein, GST-tagged

Cat.No. : GULP1-4497H
Product Overview : Human GULP1 full-length ORF ( AAH01103.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, inflammation, and autoimmunity. CED6 is an evolutionarily conserved adaptor protein required for efficient engulfment of apoptotic cells by phagocytes.[supplied by OMIM
Molecular Mass : 45.8 kDa
AA Sequence : MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCVSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GULP1 GULP, engulfment adaptor PTB domain containing 1 [ Homo sapiens ]
Official Symbol GULP1
Synonyms GULP1; GULP, engulfment adaptor PTB domain containing 1; PTB domain-containing engulfment adapter protein 1; CED 6; CED6; GULP; engulfment adapter protein; cell death protein 6 homolog; PTB domain adapter protein CED-6; PTB domain adaptor protein CED-6; CED-6; FLJ31156;
Gene ID 51454
mRNA Refseq NM_001252668
Protein Refseq NP_001239597
MIM 608165
UniProt ID Q9UBP9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GULP1 Products

Required fields are marked with *

My Review for All GULP1 Products

Required fields are marked with *

0
cart-icon