Recombinant Human GYPA Protein, GST-tagged

Cat.No. : GYPA-4508H
Product Overview : Human GYPA full-length ORF ( AAH13328.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq
Molecular Mass : 42.7 kDa
AA Sequence : MYGKIIFVLLLSAIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GYPA glycophorin A (MNS blood group) [ Homo sapiens ]
Official Symbol GYPA
Synonyms GYPA; glycophorin A (MNS blood group); glycophorin A (includes MN blood group) , glycophorin A (MN blood group) , MNS; glycophorin-A; CD235a; GPA; MN; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Erik; glycophorin A, GPA; MN sialoglycoprotein; glycophorin Sta type C; sialoglycoprotein alpha; Mi.V glycoprotein (24 AA); glycophorin A (MN blood group); recombinant glycophorin A-B Miltenberger-DR; erythroid-lineage-specific membrane sialoglycoprotein; MNS; GPSAT; PAS-2; GPErik; HGpMiV; HGpMiXI; HGpSta(C);
Gene ID 2993
mRNA Refseq NM_002099
Protein Refseq NP_002090
UniProt ID P02724

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GYPA Products

Required fields are marked with *

My Review for All GYPA Products

Required fields are marked with *

0
cart-icon
0
compare icon