Recombinant Human GYPC Protein

Cat.No. : GYPC-4511H
Product Overview : Human GYPC full-length ORF (NP_002092.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq
Form : Liquid
Molecular Mass : 13.8 kDa
AA Sequence : MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GYPC glycophorin C (Gerbich blood group) [ Homo sapiens ]
Official Symbol GYPC
Synonyms GYPC; glycophorin C (Gerbich blood group); glycophorin-C; CD236; CD236R; Ge; GPC; GYPD; glycophorin-D; glycoconnectin; glycoprotein beta; sialoglycoprotein D; GE; GPD; PAS-2; MGC117309; MGC126191; MGC126192;
Gene ID 2995
mRNA Refseq NM_001256584
Protein Refseq NP_001243513
UniProt ID P04921

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GYPC Products

Required fields are marked with *

My Review for All GYPC Products

Required fields are marked with *

0
cart-icon