Recombinant Full Length Human GZMB protein, His-tagged
| Cat.No. : | GZMB-3010H |
| Product Overview : | Recombinant Human GZMB protein(P10144)(21-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-247 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.0 kDa |
| AA Sequence : | IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) [ Homo sapiens ] |
| Official Symbol | GZMB |
| Synonyms | GZMB; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); CSPB, CTLA1; granzyme B; cathepsin G like 1; CCPI; CGL 1; CGL1; CSP B; CTSGL1; cytotoxic serine protease B; fragmentin 2; HLP; SECT; T cell serine protease 1 3E; C11; CTLA-1; fragmentin-2; cathepsin G-like 1; human lymphocyte protein; T-cell serine protease 1-3E; cytotoxic T-lymphocyte proteinase 2; CSPB; CGL-1; CSP-B; CTLA1; |
| Gene ID | 3002 |
| mRNA Refseq | NM_004131 |
| Protein Refseq | NP_004122 |
| MIM | 123910 |
| UniProt ID | P10144 |
| ◆ Recombinant Proteins | ||
| GZMB-5421H | Recombinant Full Length Human GZMB protein, His-tagged | +Inquiry |
| GZMB-3249H | Recombinant Full Length Human GZMB Protein (Ala18-Tyr247), C-His tagg | +Inquiry |
| GZMB-3093H | Recombinant Human GZMB Protein, His (Fc)-Avi-tagged | +Inquiry |
| GZMB-191H | Recombinant Human GZMB | +Inquiry |
| Gzmb-4025M | Recombinant Mouse Gzmb Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GZMB-2944HCL | Recombinant Human GZMB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMB Products
Required fields are marked with *
My Review for All GZMB Products
Required fields are marked with *
