Recombinant Human GZMB protein, His-tagged
Cat.No. : | GZMB-3010H |
Product Overview : | Recombinant Human GZMB protein(P10144)(21-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.0 kDa |
AA Sequence : | IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) [ Homo sapiens ] |
Official Symbol | GZMB |
Synonyms | GZMB; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); CSPB, CTLA1; granzyme B; cathepsin G like 1; CCPI; CGL 1; CGL1; CSP B; CTSGL1; cytotoxic serine protease B; fragmentin 2; HLP; SECT; T cell serine protease 1 3E; C11; CTLA-1; fragmentin-2; cathepsin G-like 1; human lymphocyte protein; T-cell serine protease 1-3E; cytotoxic T-lymphocyte proteinase 2; CSPB; CGL-1; CSP-B; CTLA1; |
Gene ID | 3002 |
mRNA Refseq | NM_004131 |
Protein Refseq | NP_004122 |
MIM | 123910 |
UniProt ID | P10144 |
◆ Recombinant Proteins | ||
GZMB-2634H | Recombinant Human GZMB protein, His & T7-tagged | +Inquiry |
GZMB-35H | Recombinant Human GZMB protein, GST-tagged | +Inquiry |
GZMB-3010H | Recombinant Human GZMB protein, His-tagged | +Inquiry |
GZMB-3093H | Recombinant Human GZMB Protein, His (Fc)-Avi-tagged | +Inquiry |
GZMB-3249H | Recombinant Human GZMB Protein (Ala18-Tyr247), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMB-2944HCL | Recombinant Human GZMB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GZMB Products
Required fields are marked with *
My Review for All GZMB Products
Required fields are marked with *
0
Inquiry Basket