Recombinant Full Length Human GZMB protein, His-tagged

• Cat.No.: GZMB-3010H
• Product Overview: Recombinant Human GZMB protein(P10144)(21-247aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-247 aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.0 kDa
• AA Sequence: IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GZMB granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) [ Homo sapiens ]
• Official Symbol: GZMB
• Synonyms: GZMB; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); CSPB, CTLA1; granzyme B; cathepsin G like 1; CCPI; CGL 1; CGL1; CSP B; CTSGL1; cytotoxic serine protease B; fragmentin 2; HLP; SECT; T cell serine protease 1 3E; C11; CTLA-1; fragmentin-2; cathepsin G-like 1; human lymphocyte protein; T-cell serine protease 1-3E; cytotoxic T-lymphocyte proteinase 2; CSPB; CGL-1; CSP-B; CTLA1
• Gene ID: 3002
• mRNA Refseq: NM_004131
• Protein Refseq: NP_004122
• MIM: 123910
• UniProt ID: P10144