| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
27-264 aa |
| Form : |
Lyophilized from PBS, pH7.4, 0.05% SKL, 5% Trehalose, 5% Mannitol. |
| Bio-activity : |
The purified recombinant human Granzyme K consists of residues 27 to 264 which activity was measured by its ability to cleaves a thioester substrate Z-Lys-SBzl•HCl. The reaction was performed in 0.05 M Tris, 0.15 M NaCl, 0.01% Triton X-100, pH 8.0 (assay buffer), initiated by addition 50 µL of various concentrations of GZMK (diluted by assay buffer) to 50 µL of 1.2 mM substrate and DTNB mixture. The final well serves as a negative control with no GZMK, replace with 50 µL assay buffer. Incubated at 25°C for 5min, then read at a wavelength of 405 nm. The specific activity of recombinant human Granzyme K is 59 pmol/min/µg. |
| Molecular Mass : |
The recombinant human GZMK consists of 247 amino acids and predicts a molecular mass of 27.1 kDa. |
| AASequence : |
MHHHHHHHHIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN |
| Endotoxin : |
<1.0EU per 1µg (determined by the LAL method). |
| Purity : |
> 90% as determined by SDS-PAGE. |
| Storage : |
Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.175 mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
