Recombinant Human GZMM, His-tagged
Cat.No. : | GZMM-97H |
Product Overview : | Recombinant Human Granzyme M/GZMM is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr24-Ala257) of Human GZMM fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-257 a.a. |
Description : | Granzyme M is a secreted protein that belongs to the peptidase S1 family of Granzyme subfamily. Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: Granzyme A, Granzyme B, Granzyme H, and Granzyme M. Granzyme M contains one peptidase S1 domain and is highly, constitutively expressed in activated natural killer (NK) cells. Granzyme M cleaves peptide substrates after methionine, leucine, and norleucine. Its physiological substrates include EZR, α-tubulins and the apoptosis inhibitor BIRC5/Survivin. Granzyme M promotes caspase activation and subsequent apoptosis of target cells. |
AA Sequence : | TQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPG LTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLT HQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRV LAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | GZMM granzyme M (lymphocyte met-ase 1) [ Homo sapiens ] |
Official Symbol | GZMM |
Synonyms | GZMM; granzyme M (lymphocyte met-ase 1); granzyme M; LMET1; lymphocyte met ase 1; MET1; met-ase; HU-Met-1; lymphocyte met-ase 1; Met-1 serine protease; natural killer cell granular protease; |
Gene ID | 3004 |
mRNA Refseq | NM_005317 |
Protein Refseq | NP_005308 |
MIM | 600311 |
UniProt ID | P51124 |
Chromosome Location | 19p13.3 |
Function | peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
Gzmm-651M | Recombinant Mouse Gzmm Protein, His/GST-tagged | +Inquiry |
GZMM-97H | Recombinant Human GZMM, His-tagged | +Inquiry |
GZMM-4526H | Recombinant Human GZMM Protein, GST-tagged | +Inquiry |
GZMM-98H | Active Recombinant Human GZMM protein, His-tagged | +Inquiry |
GZMM-3394HF | Recombinant Full Length Human GZMM Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMM-5666HCL | Recombinant Human GZMM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMM Products
Required fields are marked with *
My Review for All GZMM Products
Required fields are marked with *