Recombinant Human H1-1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: H1-1-4920H
• Product Overview: HIST1H1A MS Standard C13 and N15-labeled recombinant protein (NP_005316) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.
• Molecular Mass: 21.8 kDa
• AA Sequence: MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: H1-1 H1.1 linker histone, cluster member [ Homo sapiens (human) ]
• Official Symbol: H1-1
• Synonyms: HIST1H1A; histone cluster 1, H1a; H1 histone family, member 1, H1F1, histone 1, H1a; histone H1.1; H1.1; H1a; histone 1, H1a; H1 histone family, member 1; H1A; H1F1; HIST1; MGC126642; MGC138345
• Gene ID: 3024
• mRNA Refseq: NM_005325
• Protein Refseq: NP_005316
• MIM: 142709
• UniProt ID: Q02539