Recombinant Human H1F0 protein(31-160 aa), C-His-tagged

• Cat.No.: H1F0-2578H
• Product Overview: Recombinant Human H1F0 protein(P07305)(31-160 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 31-160 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKP

Gene Information

• Gene Name: H1F0 H1 histone family, member 0 [ Homo sapiens ]
• Official Symbol: H1F0
• Synonyms: H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241
• Gene ID: 3005
• mRNA Refseq: NM_005318
• Protein Refseq: NP_005309
• MIM: 142708
• UniProt ID: P07305