Recombinant Human H1F0 protein(31-160 aa), C-His-tagged

Cat.No. : H1F0-2578H
Product Overview : Recombinant Human H1F0 protein(P07305)(31-160 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-160 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKP
Gene Name H1F0 H1 histone family, member 0 [ Homo sapiens ]
Official Symbol H1F0
Synonyms H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241;
Gene ID 3005
mRNA Refseq NM_005318
Protein Refseq NP_005309
MIM 142708
UniProt ID P07305

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H1F0 Products

Required fields are marked with *

My Review for All H1F0 Products

Required fields are marked with *

0
cart-icon