Recombinant Human H2AC21 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: H2AC21-4001H
• Product Overview: HIST2H2AB MS Standard C13 and N15-labeled recombinant protein (NP_778235) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element.
• Molecular Mass: 13.8 kDa
• AA Sequence: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: H2AC21 H2A clustered histone 21 [ Homo sapiens (human) ]
• Official Symbol: H2AC21
• Synonyms: HIST2H2AB; histone cluster 2, H2ab; H2AB; HIST2H2AB; histone H2A type 2-B; histone 2, H2ab; histone cluster 2 H2A family member b; histone cluster 2, H2ab
• Gene ID: 317772
• mRNA Refseq: NM_175065
• Protein Refseq: NP_778235
• MIM: 615014
• UniProt ID: Q8IUE6