Recombinant Human H2AC21 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : H2AC21-4001H
Product Overview : HIST2H2AB MS Standard C13 and N15-labeled recombinant protein (NP_778235) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element.
Molecular Mass : 13.8 kDa
AA Sequence : MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name H2AC21 H2A clustered histone 21 [ Homo sapiens (human) ]
Official Symbol H2AC21
Synonyms HIST2H2AB; histone cluster 2, H2ab; H2AB; HIST2H2AB; histone H2A type 2-B; histone 2, H2ab; histone cluster 2 H2A family member b; histone cluster 2, H2ab
Gene ID 317772
mRNA Refseq NM_175065
Protein Refseq NP_778235
MIM 615014
UniProt ID Q8IUE6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AC21 Products

Required fields are marked with *

My Review for All H2AC21 Products

Required fields are marked with *

0
cart-icon
0
compare icon