Recombinant Human H2AFB3 Protein, GST-tagged
Cat.No. : | H2AFB3-4533H |
Product Overview : | Human H2AFB3 full-length ORF ( ADR82798.1, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most telomeric copy. [provided by RefSeq |
Molecular Mass : | 12.7 kDa |
AA Sequence : | MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2AFB3 H2A histone family, member B3 [ Homo sapiens ] |
Official Symbol | H2AFB3 |
Synonyms | H2AFB3; H2A histone family, member B3; H2A histone family, member B , H2AFB; histone H2A-Bbd type 2/3; H2A.Bbd; H2A Barr body-deficient; histone variant H2A, Barr-body deficient; H2AFB; H2ABBD; H2AFB2; |
Gene ID | 83740 |
mRNA Refseq | NM_080720 |
Protein Refseq | NP_542451 |
MIM | 300445 |
UniProt ID | P0C5Z0 |
◆ Recombinant Proteins | ||
H2AFB3-3401HF | Recombinant Full Length Human H2AFB3 Protein, GST-tagged | +Inquiry |
H2AFB3-1846R | Recombinant Rhesus Macaque H2AFB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFB3-4533H | Recombinant Human H2AFB3 Protein, GST-tagged | +Inquiry |
H2AFB3-2025R | Recombinant Rhesus monkey H2AFB3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFB3-314HCL | Recombinant Human H2AFB3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFB3 Products
Required fields are marked with *
My Review for All H2AFB3 Products
Required fields are marked with *