Recombinant Human H2AFJ Protein, GST-tagged

Cat.No. : H2AFJ-4535H
Product Overview : Human H2AFJ full-length ORF (BAA91894.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is located on chromosome 12 and encodes a variant H2A histone. The protein is divergent at the C-terminus compared to the consensus H2A histone family member. [provided by RefSeq
Molecular Mass : 42.5 kDa
AA Sequence : MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPVCEHSGPSSGKIPSDRAELGAGSVCGHIFQKVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H2AFJ H2A histone family, member J [ Homo sapiens ]
Official Symbol H2AFJ
Synonyms H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ
Gene ID 55766
mRNA Refseq NM_177925
Protein Refseq NP_808760
UniProt ID Q9BTM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AFJ Products

Required fields are marked with *

My Review for All H2AFJ Products

Required fields are marked with *

0
cart-icon
0
compare icon