Recombinant Human H2AFJ Protein, GST-tagged
Cat.No. : | H2AFJ-4535H |
Product Overview : | Human H2AFJ full-length ORF (BAA91894.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is located on chromosome 12 and encodes a variant H2A histone. The protein is divergent at the C-terminus compared to the consensus H2A histone family member. [provided by RefSeq |
Molecular Mass : | 42.5 kDa |
AA Sequence : | MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPVCEHSGPSSGKIPSDRAELGAGSVCGHIFQKVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2AFJ H2A histone family, member J [ Homo sapiens ] |
Official Symbol | H2AFJ |
Synonyms | H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ |
Gene ID | 55766 |
mRNA Refseq | NM_177925 |
Protein Refseq | NP_808760 |
UniProt ID | Q9BTM1 |
◆ Recombinant Proteins | ||
H2AFJ-4041M | Recombinant Mouse H2AFJ Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFJ-13644H | Recombinant Human H2AFJ, GST-tagged | +Inquiry |
H2AFJ-1847R | Recombinant Rhesus Macaque H2AFJ Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFJ-3402HF | Recombinant Full Length Human H2AFJ Protein, GST-tagged | +Inquiry |
H2AFJ-4535H | Recombinant Human H2AFJ Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFJ-5662HCL | Recombinant Human H2AFJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2AFJ Products
Required fields are marked with *
My Review for All H2AFJ Products
Required fields are marked with *
0
Inquiry Basket