Recombinant Human H2AFJ protein, GST-tagged

• Cat.No.: H2AFJ-3011H
• Product Overview: Recombinant Human H2AFJ protein(Q9BTM1)(2-129aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 2-129aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.9 kDa
• AA Sequence: SGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: H2AFJ H2A histone family, member J [ Homo sapiens ]
• Official Symbol: H2AFJ
• Synonyms: H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ
• Gene ID: 55766
• mRNA Refseq: NM_177925.2
• Protein Refseq: NP_808760.1
• UniProt ID: Q9BTM1