Recombinant Human H2AFJ protein, GST-tagged
Cat.No. : | H2AFJ-3011H |
Product Overview : | Recombinant Human H2AFJ protein(Q9BTM1)(2-129aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-129aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.9 kDa |
AA Sequence : | SGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | H2AFJ H2A histone family, member J [ Homo sapiens ] |
Official Symbol | H2AFJ |
Synonyms | H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ |
Gene ID | 55766 |
mRNA Refseq | NM_177925.2 |
Protein Refseq | NP_808760.1 |
UniProt ID | Q9BTM1 |
◆ Recombinant Proteins | ||
H2AFJ-2429R | Recombinant Rat H2AFJ Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFJ-4041M | Recombinant Mouse H2AFJ Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFJ-1847R | Recombinant Rhesus Macaque H2AFJ Protein, His (Fc)-Avi-tagged | +Inquiry |
H2AFJ-3700H | Recombinant Human H2AFJ Protein (Gly3-Lys129), His tagged | +Inquiry |
H2AFJ-2026R | Recombinant Rhesus monkey H2AFJ Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFJ-5662HCL | Recombinant Human H2AFJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2AFJ Products
Required fields are marked with *
My Review for All H2AFJ Products
Required fields are marked with *
0
Inquiry Basket