Recombinant Human H2AFJ protein, GST-tagged

Cat.No. : H2AFJ-3011H
Product Overview : Recombinant Human H2AFJ protein(Q9BTM1)(2-129aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-129aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 40.9 kDa
AA Sequence : SGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name H2AFJ H2A histone family, member J [ Homo sapiens ]
Official Symbol H2AFJ
Synonyms H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ
Gene ID 55766
mRNA Refseq NM_177925.2
Protein Refseq NP_808760.1
UniProt ID Q9BTM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AFJ Products

Required fields are marked with *

My Review for All H2AFJ Products

Required fields are marked with *

0
cart-icon