Recombinant Human H2AFY2 Protein, GST-tagged
Cat.No. : | H2AFY2-4539H |
Product Overview : | Human H2AFY2 full-length ORF ( NP_061119.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and may participate in stable X chromosome inactivation. [provided by RefSeq, Oct 2015] |
Molecular Mass : | 66.5 kDa |
AA Sequence : | MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2AFY2 H2A histone family, member Y2 [ Homo sapiens ] |
Official Symbol | H2AFY2 |
Synonyms | H2AFY2; H2A histone family, member Y2; core histone macro-H2A.2; macroH2A2; mH2A2; histone macroH2A2; core histone macroH2A2.2; |
Gene ID | 55506 |
mRNA Refseq | NM_018649 |
Protein Refseq | NP_061119 |
UniProt ID | Q9P0M6 |
◆ Recombinant Proteins | ||
H2AFY2-2029R | Recombinant Rhesus monkey H2AFY2 Protein, His-tagged | +Inquiry |
H2AFY2-7431M | Recombinant Mouse H2AFY2 Protein | +Inquiry |
H2AFY2-4762C | Recombinant Chicken H2AFY2 | +Inquiry |
H2AFY2-13648H | Recombinant Full Length Human H2AFY2 | +Inquiry |
H2AFY2-3124Z | Recombinant Zebrafish H2AFY2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFY2-5656HCL | Recombinant Human H2AFY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFY2 Products
Required fields are marked with *
My Review for All H2AFY2 Products
Required fields are marked with *