Recombinant Human H2AFZ Protein, GST-tagged

Cat.No. : H2AFZ-4540H
Product Overview : Human H2AFZ full-length ORF ( AAH18002, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq
Molecular Mass : 39.82 kDa
AA Sequence : MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H2AFZ H2A histone family, member Z [ Homo sapiens ]
Official Symbol H2AFZ
Synonyms H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z; H2AZ histone; H2A.z; H2A/z; MGC117173;
Gene ID 3015
mRNA Refseq NM_002106
Protein Refseq NP_002097
MIM 142763
UniProt ID P0C0S5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AFZ Products

Required fields are marked with *

My Review for All H2AFZ Products

Required fields are marked with *

0
cart-icon