Recombinant Human H2BC14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : H2BC14-3079H
Product Overview : HIST1H2BM MS Standard C13 and N15-labeled recombinant protein (NP_003512) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3.
Molecular Mass : 14 kDa
AA Sequence : MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name H2BC14 H2B clustered histone 14 [ Homo sapiens (human) ]
Official Symbol H2BC14
Synonyms H2BC14; H2B clustered histone 14; H2B/e; H2BFE; HIST1H2BM; dJ160A22.3; histone H2B type 1-M; H2B histone family, member E; histone 1, H2bm; histone H2B.e; histone cluster 1 H2B family member m; histone cluster 1, H2bm
Gene ID 8342
mRNA Refseq NM_003521
Protein Refseq NP_003512
MIM 602802
UniProt ID Q99879

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2BC14 Products

Required fields are marked with *

My Review for All H2BC14 Products

Required fields are marked with *

0
cart-icon
0
compare icon