Recombinant Human HACD3 Protein, GST-tagged

• Cat.No.: HACD3-5270H
• Product Overview: Human HSPC121 partial ORF ( NP_057479, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HACD3 (3-Hydroxyacyl-CoA Dehydratase 3) is a Protein Coding gene. Among its related pathways are Fatty acid elongation and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include enzyme binding and lyase activity. An important paralog of this gene is HACD4.
• Molecular Mass: 38.17 kDa
• AA Sequence: MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HACD3 3-hydroxyacyl-CoA dehydratase 3 [ Homo sapiens (human) ]
• Official Symbol: HACD3
• Synonyms: HACD3; 3-hydroxyacyl-CoA dehydratase 3; PTPLAD1; protein tyrosine phosphatase-like A domain containing 1; 3-hydroxyacyl-CoA dehydratase 3; B ind1; HSPC121; hB-ind1; butyrate-induced protein 1; butyrate-induced transcript 1; protein tyrosine phosphatase-like protein PTPLAD1; protein-tyrosine phosphatase-like A domain-containing protein 1; HACD3; B-IND1; FLJ90376
• Gene ID: 51495
• mRNA Refseq: NM_016395
• Protein Refseq: NP_057479
• UniProt ID: Q9P035