Recombinant Human HACD3 Protein, GST-tagged
| Cat.No. : | HACD3-5270H |
| Product Overview : | Human HSPC121 partial ORF ( NP_057479, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HACD3 (3-Hydroxyacyl-CoA Dehydratase 3) is a Protein Coding gene. Among its related pathways are Fatty acid elongation and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include enzyme binding and lyase activity. An important paralog of this gene is HACD4. |
| Molecular Mass : | 38.17 kDa |
| AA Sequence : | MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HACD3 3-hydroxyacyl-CoA dehydratase 3 [ Homo sapiens (human) ] |
| Official Symbol | HACD3 |
| Synonyms | HACD3; 3-hydroxyacyl-CoA dehydratase 3; PTPLAD1; protein tyrosine phosphatase-like A domain containing 1; 3-hydroxyacyl-CoA dehydratase 3; B ind1; HSPC121; hB-ind1; butyrate-induced protein 1; butyrate-induced transcript 1; protein tyrosine phosphatase-like protein PTPLAD1; protein-tyrosine phosphatase-like A domain-containing protein 1; HACD3; B-IND1; FLJ90376; |
| Gene ID | 51495 |
| mRNA Refseq | NM_016395 |
| Protein Refseq | NP_057479 |
| UniProt ID | Q9P035 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HACD3 Products
Required fields are marked with *
My Review for All HACD3 Products
Required fields are marked with *



