Recombinant Human HADHB Protein, His-tagged

• Cat.No.: HADHB-12H
• Product Overview: Recombinant Human HADHB Protein(P55084)(111-270 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 111-270 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 19 kDa
• AASequence: KTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVP
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: HADHB hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit [ Homo sapiens ]
• Official Symbol: HADHB
• Synonyms: HADHB; hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit; hydroxyacyl Coenzyme A dehydrogenase/3 ketoacyl Coenzyme A thiolase/enoyl Coenzyme A hydratase (trifunctional protein), beta subunit; trifunctional enzyme subunit beta, mitochondrial; mitochondrial trifunctional protein; beta subunit; MTPB; beta-ketothiolase; acetyl-CoA acyltransferase; 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit; mitochondrial trifunctional enzyme, beta subunit; mitochondrial trifunctional protein, beta subunit; hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit; 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, beta subunit; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit; ECHB; MSTP029; TP-BETA; MGC87480
• Gene ID: 3032
• mRNA Refseq: NM_000183
• Protein Refseq: NP_000174
• MIM: 143450
• UniProt ID: P55084