Recombinant Human HAND2 Protein, GST-tagged
Cat.No. : | HAND2-4568H |
Product Overview : | Human HAND2 full-length ORF ( AAI01407.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq |
Molecular Mass : | 46.7 kDa |
AA Sequence : | MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAND2 heart and neural crest derivatives expressed 2 [ Homo sapiens ] |
Official Symbol | HAND2 |
Synonyms | HAND2; heart and neural crest derivatives expressed 2; heart- and neural crest derivatives-expressed protein 2; bHLHa26; dHand; Hed; Thing2; class A basic helix-loop-helix protein 26; basic helix-loop-helix transcription factor HAND2; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; DHAND2; FLJ16260; MGC125303; MGC125304; |
Gene ID | 9464 |
mRNA Refseq | NM_021973 |
Protein Refseq | NP_068808 |
MIM | 602407 |
UniProt ID | P61296 |
◆ Recombinant Proteins | ||
HAND2-9164Z | Recombinant Zebrafish HAND2 | +Inquiry |
HAND2-2034R | Recombinant Rhesus monkey HAND2 Protein, His-tagged | +Inquiry |
HAND2-4568H | Recombinant Human HAND2 Protein, GST-tagged | +Inquiry |
HAND2-2441R | Recombinant Rat HAND2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAND2-4054M | Recombinant Mouse HAND2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAND2 Products
Required fields are marked with *
My Review for All HAND2 Products
Required fields are marked with *
0
Inquiry Basket