Recombinant Human HAND2 protein, GST-tagged

• Cat.No.: HAND2-3015H
• Product Overview: Recombinant Human HAND2 protein(P61296)(1-180aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-180aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.3 kDa
• AA Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HAND2 heart and neural crest derivatives expressed 2 [ Homo sapiens ]
• Official Symbol: HAND2
• Synonyms: HAND2; heart and neural crest derivatives expressed 2; heart- and neural crest derivatives-expressed protein 2; bHLHa26; dHand; Hed; Thing2; class A basic helix-loop-helix protein 26; basic helix-loop-helix transcription factor HAND2; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; DHAND2; FLJ16260; MGC125303; MGC125304
• Gene ID: 9464
• mRNA Refseq: NM_021973
• Protein Refseq: NP_068808
• MIM: 602407
• UniProt ID: P61296