Recombinant Human HAND2 protein, GST-tagged
Cat.No. : | HAND2-3015H |
Product Overview : | Recombinant Human HAND2 protein(P61296)(1-180aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-180aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HAND2 heart and neural crest derivatives expressed 2 [ Homo sapiens ] |
Official Symbol | HAND2 |
Synonyms | HAND2; heart and neural crest derivatives expressed 2; heart- and neural crest derivatives-expressed protein 2; bHLHa26; dHand; Hed; Thing2; class A basic helix-loop-helix protein 26; basic helix-loop-helix transcription factor HAND2; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; DHAND2; FLJ16260; MGC125303; MGC125304; |
Gene ID | 9464 |
mRNA Refseq | NM_021973 |
Protein Refseq | NP_068808 |
MIM | 602407 |
UniProt ID | P61296 |
◆ Recombinant Proteins | ||
HAND2-4568H | Recombinant Human HAND2 Protein, GST-tagged | +Inquiry |
HAND2-2034R | Recombinant Rhesus monkey HAND2 Protein, His-tagged | +Inquiry |
HAND2-2787R | Recombinant Rat HAND2 Protein | +Inquiry |
HAND2-3350HF | Recombinant Full Length Human HAND2 Protein, GST-tagged | +Inquiry |
HAND2-3015H | Recombinant Human HAND2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAND2 Products
Required fields are marked with *
My Review for All HAND2 Products
Required fields are marked with *
0
Inquiry Basket