Recombinant Human HAO1, TraxA/His-tagged

• Cat.No.: HAO1-99H
• Product Overview: Recombinant Human Hydroxyacid Oxidase 1/HAO1 isproduced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ile370) of Human HAO1 fused with a TraxA/His tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His&TRxA
• Protein Length: 1-370 a.a.
• Description: Hydroxyacid Oxidase 1 (HAO1) is an enzyme that belongs to the FMN-Dependent α-Hydroxy Acid Dehydrogenase family. HAO1 contains 1 FMN Hydroxy Ccid Dehydrogenase domain. HAO1 is expressed primarily in the liver and pancreas. This protein has 2-Hydroxyacid Oxidase activity. Most HAO1 is active on the 2-Carbon substrate Glycolate, but it can also be active on 2-Hydroxy fatty acids, with higher activity towards 2-Hydroxy Palmitate and 2-Hydroxy Octanoate.
• Form: Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMLPRLICINDYEQHAKSVLPKSIYDYYRSG ANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATV RACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVD TPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWL RRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFL DGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVI DKTLVRKNPLAVSKI
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: HAO1 hydroxyacid oxidase (glycolate oxidase) 1 [ Homo sapiens ]
• Official Symbol: HAO1
• Synonyms: HAO1; hydroxyacid oxidase (glycolate oxidase) 1; GOX1; hydroxyacid oxidase 1; GOX; glycolate oxidase; (S)-2-hydroxy-acid oxidase; HAOX1; MGC142225; MGC142227
• Gene ID: 54363
• mRNA Refseq: NM_017545
• Protein Refseq: NP_060015
• MIM: 605023
• UniProt ID: Q9UJM8
• Chromosome Location: 20p12
• Pathway: Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Glyoxylate metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peroxisome, organism-specific biosystem
• Function: (S)-2-hydroxy-acid oxidase activity; FMN binding; glycolate oxidase activity; glycolate oxidase activity; glyoxylate oxidase activity; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity; medium-chain-(S)-2-hydroxy-acid oxidase activity; oxidoreductase activity; very-long-chain-(S)-2-hydroxy-acid oxidase activity