Recombinant Human HAO1, TraxA/His-tagged
| Cat.No. : | HAO1-99H |
| Product Overview : | Recombinant Human Hydroxyacid Oxidase 1/HAO1 isproduced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ile370) of Human HAO1 fused with a TraxA/His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&TRxA |
| Protein Length : | 1-370 a.a. |
| Description : | Hydroxyacid Oxidase 1 (HAO1) is an enzyme that belongs to the FMN-Dependent α-Hydroxy Acid Dehydrogenase family. HAO1 contains 1 FMN Hydroxy Ccid Dehydrogenase domain. HAO1 is expressed primarily in the liver and pancreas. This protein has 2-Hydroxyacid Oxidase activity. Most HAO1 is active on the 2-Carbon substrate Glycolate, but it can also be active on 2-Hydroxy fatty acids, with higher activity towards 2-Hydroxy Palmitate and 2-Hydroxy Octanoate. |
| Form : | Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMLPRLICINDYEQHAKSVLPKSIYDYYRSG ANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATV RACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVD TPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWL RRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFL DGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVI DKTLVRKNPLAVSKI |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Store at Please minimize freeze-thaw cycles. |
| Gene Name | HAO1 hydroxyacid oxidase (glycolate oxidase) 1 [ Homo sapiens ] |
| Official Symbol | HAO1 |
| Synonyms | HAO1; hydroxyacid oxidase (glycolate oxidase) 1; GOX1; hydroxyacid oxidase 1; GOX; glycolate oxidase; (S)-2-hydroxy-acid oxidase; HAOX1; MGC142225; MGC142227; |
| Gene ID | 54363 |
| mRNA Refseq | NM_017545 |
| Protein Refseq | NP_060015 |
| MIM | 605023 |
| UniProt ID | Q9UJM8 |
| Chromosome Location | 20p12 |
| Pathway | Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Glyoxylate metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peroxisome, organism-specific biosystem; |
| Function | (S)-2-hydroxy-acid oxidase activity; FMN binding; glycolate oxidase activity; glycolate oxidase activity; glyoxylate oxidase activity; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity; medium-chain-(S)-2-hydroxy-acid oxidase activity; oxidoreductase activity; very-long-chain-(S)-2-hydroxy-acid oxidase activity; |
| ◆ Recombinant Proteins | ||
| HAO1-1042H | Recombinant Human HAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HAO1-796H | Recombinant Human HAO1 Protein | +Inquiry |
| Hao1-458R | Recombinant Rat Hao1 Protein, His-tagged | +Inquiry |
| Hao1-4957M | Recombinant Mouse Hao1 protein, His-tagged | +Inquiry |
| HAO1-4570H | Recombinant Human HAO1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAO1-5638HCL | Recombinant Human HAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAO1 Products
Required fields are marked with *
My Review for All HAO1 Products
Required fields are marked with *
