Recombinant Human HAO1, TraxA/His-tagged
Cat.No. : | HAO1-99H |
Product Overview : | Recombinant Human Hydroxyacid Oxidase 1/HAO1 isproduced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ile370) of Human HAO1 fused with a TraxA/His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&TRxA |
Protein Length : | 1-370 a.a. |
Description : | Hydroxyacid Oxidase 1 (HAO1) is an enzyme that belongs to the FMN-Dependent α-Hydroxy Acid Dehydrogenase family. HAO1 contains 1 FMN Hydroxy Ccid Dehydrogenase domain. HAO1 is expressed primarily in the liver and pancreas. This protein has 2-Hydroxyacid Oxidase activity. Most HAO1 is active on the 2-Carbon substrate Glycolate, but it can also be active on 2-Hydroxy fatty acids, with higher activity towards 2-Hydroxy Palmitate and 2-Hydroxy Octanoate. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMLPRLICINDYEQHAKSVLPKSIYDYYRSG ANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATV RACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVD TPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWL RRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFL DGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVI DKTLVRKNPLAVSKI |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | HAO1 hydroxyacid oxidase (glycolate oxidase) 1 [ Homo sapiens ] |
Official Symbol | HAO1 |
Synonyms | HAO1; hydroxyacid oxidase (glycolate oxidase) 1; GOX1; hydroxyacid oxidase 1; GOX; glycolate oxidase; (S)-2-hydroxy-acid oxidase; HAOX1; MGC142225; MGC142227; |
Gene ID | 54363 |
mRNA Refseq | NM_017545 |
Protein Refseq | NP_060015 |
MIM | 605023 |
UniProt ID | Q9UJM8 |
Chromosome Location | 20p12 |
Pathway | Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Glyoxylate metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peroxisome, organism-specific biosystem; |
Function | (S)-2-hydroxy-acid oxidase activity; FMN binding; glycolate oxidase activity; glycolate oxidase activity; glyoxylate oxidase activity; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity; medium-chain-(S)-2-hydroxy-acid oxidase activity; oxidoreductase activity; very-long-chain-(S)-2-hydroxy-acid oxidase activity; |
◆ Recombinant Proteins | ||
HAO1-4308C | Recombinant Chicken HAO1 | +Inquiry |
Hao1-458R | Recombinant Rat Hao1 Protein, His-tagged | +Inquiry |
HAO1-5403Z | Recombinant Zebrafish HAO1 | +Inquiry |
HAO1-3820H | Recombinant Human HAO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HAO1-1303HFL | Recombinant Full Length Human HAO1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAO1-5638HCL | Recombinant Human HAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAO1 Products
Required fields are marked with *
My Review for All HAO1 Products
Required fields are marked with *
0
Inquiry Basket